Lineage for d2ob7c1 (2ob7 C:3-124)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 965864Fold b.111: Small protein B (SmpB) [74981] (1 superfamily)
    barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold
  4. 965865Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) (S)
  5. 965866Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein)
  6. 965867Protein Small protein B (SmpB) [74984] (2 species)
    tmRNA-binding protein; SsrA-binding protein
  7. 965868Species Aquifex aeolicus [TaxId:63363] [74985] (4 PDB entries)
  8. 965874Domain d2ob7c1: 2ob7 C:3-124 [139005]
    automatically matched to d1k8ha_
    protein/RNA complex

Details for d2ob7c1

PDB Entry: 2ob7 (more details), 13.6 Å

PDB Description: structure of tmrna-(smpb)2 complex as inferred from cryo-em
PDB Compounds: (C:) SsrA-binding protein

SCOPe Domain Sequences for d2ob7c1:

Sequence, based on SEQRES records: (download)

>d2ob7c1 b.111.1.1 (C:3-124) Small protein B (SmpB) {Aquifex aeolicus [TaxId: 63363]}
sdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeawly
nlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkvli
al

Sequence, based on observed residues (ATOM records): (download)

>d2ob7c1 b.111.1.1 (C:3-124) Small protein B (SmpB) {Aquifex aeolicus [TaxId: 63363]}
sdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeawly
nlyiapykhanhdplrkrklllhkreimrlygkvqeiiplklywknnkvkvlial

SCOPe Domain Coordinates for d2ob7c1:

Click to download the PDB-style file with coordinates for d2ob7c1.
(The format of our PDB-style files is described here.)

Timeline for d2ob7c1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ob7b1