Lineage for d2ob7b1 (2ob7 B:3-130)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 812230Fold b.111: Small protein B (SmpB) [74981] (1 superfamily)
    barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold
  4. 812231Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) (S)
  5. 812232Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein)
  6. 812233Protein Small protein B (SmpB) [74984] (2 species)
    tmRNA-binding protein; SsrA-binding protein
  7. 812234Species Aquifex aeolicus [TaxId:63363] [74985] (4 PDB entries)
  8. 812239Domain d2ob7b1: 2ob7 B:3-130 [139004]
    automatically matched to d1k8ha_

Details for d2ob7b1

PDB Entry: 2ob7 (more details), 13.6 Å

PDB Description: structure of tmrna-(smpb)2 complex as inferred from cryo-em
PDB Compounds: (B:) SsrA-binding protein

SCOP Domain Sequences for d2ob7b1:

Sequence, based on SEQRES records: (download)

>d2ob7b1 b.111.1.1 (B:3-130) Small protein B (SmpB) {Aquifex aeolicus [TaxId: 63363]}
sdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeawly
nlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkvli
alakgkkl

Sequence, based on observed residues (ATOM records): (download)

>d2ob7b1 b.111.1.1 (B:3-130) Small protein B (SmpB) {Aquifex aeolicus [TaxId: 63363]}
sdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeawly
nlyiapynhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkvlialakgk
kl

SCOP Domain Coordinates for d2ob7b1:

Click to download the PDB-style file with coordinates for d2ob7b1.
(The format of our PDB-style files is described here.)

Timeline for d2ob7b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ob7c1