Lineage for d2ob7b1 (2ob7 B:3-130)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821154Fold b.111: Small protein B (SmpB) [74981] (2 superfamilies)
    barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold
  4. 2821155Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) (S)
  5. 2821156Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein)
  6. 2821157Protein Small protein B (SmpB) [74984] (2 species)
    tmRNA-binding protein; SsrA-binding protein
  7. 2821162Species Thermus thermophilus [TaxId:274] [82130] (5 PDB entries)
    Uniprot Q8RR57 4-123
  8. 2821170Domain d2ob7b1: 2ob7 B:3-130 [139004]
    automatically matched to d1k8ha_
    protein/RNA complex

Details for d2ob7b1

PDB Entry: 2ob7 (more details)

PDB Description: structure of tmrna-(smpb)2 complex as inferred from cryo-em
PDB Compounds: (B:) SsrA-binding protein

SCOPe Domain Sequences for d2ob7b1:

Sequence, based on SEQRES records: (download)

>d2ob7b1 b.111.1.1 (B:3-130) Small protein B (SmpB) {Thermus thermophilus [TaxId: 274]}
sdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeawly
nlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkvli
alakgkkl

Sequence, based on observed residues (ATOM records): (download)

>d2ob7b1 b.111.1.1 (B:3-130) Small protein B (SmpB) {Thermus thermophilus [TaxId: 274]}
sdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeawly
nlyiapynhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkvlialakgk
kl

SCOPe Domain Coordinates for d2ob7b1:

Click to download the PDB-style file with coordinates for d2ob7b1.
(The format of our PDB-style files is described here.)

Timeline for d2ob7b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ob7c1