Lineage for d2ob2c_ (2ob2 C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1379309Family c.66.1.37: Leucine carboxy methyltransferase Ppm1 [102569] (1 protein)
  6. 1379310Protein Leucine carboxy methyltransferase Ppm1 [102570] (1 species)
    involved in the regulation of protein phosphatase 2a activity
  7. 1379311Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102571] (6 PDB entries)
  8. 1379320Domain d2ob2c_: 2ob2 C: [139003]
    automated match to d1rjda_
    complexed with gol, po4, sah

Details for d2ob2c_

PDB Entry: 2ob2 (more details), 1.92 Å

PDB Description: ppm1 in the absence of 1,8-ANS (cf 1JD)
PDB Compounds: (C:) Leucine carboxyl methyltransferase 1

SCOPe Domain Sequences for d2ob2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ob2c_ c.66.1.37 (C:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eriiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafg
kvdkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfph
layvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlndite
ttrlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpnd
rfgaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkr
lrslqfldeleelkvmqthyilmkaqw

SCOPe Domain Coordinates for d2ob2c_:

Click to download the PDB-style file with coordinates for d2ob2c_.
(The format of our PDB-style files is described here.)

Timeline for d2ob2c_: