Lineage for d2oaza2 (2oaz A:1-374,A:449-478)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538139Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2538140Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2538141Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2538190Protein Methionine aminopeptidase [55924] (6 species)
  7. 2538242Species Human (Homo sapiens) [TaxId:9606] [55927] (18 PDB entries)
    Uniprot P50579 110-478
    methionine aminopeptidase 2 contains insert domain with a circularly permuted "winged helix" fold
  8. 2538255Domain d2oaza2: 2oaz A:1-374,A:449-478 [139000]
    Other proteins in same PDB: d2oaza1
    automated match to d1r58a2
    complexed with co, i96

Details for d2oaza2

PDB Entry: 2oaz (more details), 1.9 Å

PDB Description: Human Methionine Aminopeptidase-2 Complexed with SB-587094
PDB Compounds: (A:) human Methionine Amino Peptidase 2

SCOPe Domain Sequences for d2oaza2:

Sequence, based on SEQRES records: (download)

>d2oaza2 d.127.1.1 (A:1-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]}
kvqtdppsvpicdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndf
reaaeahrqvrkyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnnca
ahytpnagdttvlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgik
cagidvrlcdvgeaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikg
geatrmeegevyaietfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

Sequence, based on observed residues (ATOM records): (download)

>d2oaza2 d.127.1.1 (A:1-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]}
kvqtdppsvpicdlypngvfpkgqeceypeekkaldqaseeiwndfreaaeahrqvrkyv
mswikpgmtmieicekledcsrklikenglnaglafptgcslnncaahytpnagdttvlq
yddickidfgthisgriidcaftvtfnpkydtllkavkdatntgikcagidvrlcdvgea
iqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikggeatrmeegevyai
etfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

SCOPe Domain Coordinates for d2oaza2:

Click to download the PDB-style file with coordinates for d2oaza2.
(The format of our PDB-style files is described here.)

Timeline for d2oaza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oaza1