SCOPe 2.07: Domain d2oaza1: 2oaz A:375-448

Lineage for d2oaza1 (2oaz A:375-448)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
   circularly permuted version of the "winged helix" fold

6. Protein Methionine aminopeptidase, insert domain [46888] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46890] (18 PDB entries)
   Uniprot P50579 110-478

8. Domain d2oaza1: 2oaz A:375-448 [138999]
   Other proteins in same PDB: d2oaza2
   automated match to d1r58a1
   complexed with co, i96

Details for d2oaza1

PDB Entry: 2oaz, 1.9 Å

PDB Description: human methionine aminopeptidase-2 complexed with sb-587094

PDB Compounds: (A:) human Methionine Amino Peptidase 2

SCOPe Domain Sequences for d2oaza1:

Sequence; same for both SEQRES and ATOM records:

>d2oaza1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens) [TaxId: 9606]}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

Timeline for d2oaza1:

• d2oaza1 first appeared in SCOP 1.73
  
• d2oaza1 appears in SCOPe 2.06
  
• d2oaza1 appears in the current release, SCOPe 2.08