![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein) circularly permuted version of the "winged helix" fold |
![]() | Protein Methionine aminopeptidase, insert domain [46888] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46890] (16 PDB entries) |
![]() | Domain d2oaza1: 2oaz A:375-448 [138999] Other proteins in same PDB: d2oaza2 automatically matched to d1b59a1 complexed with co, i96 |
PDB Entry: 2oaz (more details), 1.9 Å
SCOP Domain Sequences for d2oaza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oaza1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens) [TaxId: 9606]} hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn lcdlgivdpypplc
Timeline for d2oaza1: