SCOP 1.75: Domain d2oaue3: 2oau E:27-112

Lineage for d2oaue3 (2oau E:27-112)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.34: Mechanosensitive channel protein MscS (YggB), transmembrane region [82860] (1 superfamily)
   oligomeric fold; 3 transmembrane helices per subunit

4. Superfamily f.34.1: Mechanosensitive channel protein MscS (YggB), transmembrane region [82861] (1 family)

5. Family f.34.1.1: Mechanosensitive channel protein MscS (YggB), transmembrane region [82862] (1 protein)

6. Protein Mechanosensitive channel protein MscS (YggB), transmembrane region [82863] (1 species)
   homoheptameric protein

7. Species Escherichia coli [TaxId:562] [82864] (2 PDB entries)

8. Domain d2oaue3: 2oau E:27-112 [138992]
   Other proteins in same PDB: d2oaua1, d2oaua2, d2oaub1, d2oaub2, d2oauc1, d2oauc2, d2oaud1, d2oaud2, d2oaue1, d2oaue2, d2oauf1, d2oauf2, d2oaug1, d2oaug2
   automatically matched to d1mxma3

Details for d2oaue3

PDB Entry: 2oau, 3.7 Å

PDB Description: Mechanosensitive Channel of Small Conductance (MscS)

PDB Compounds: (E:) Small-conductance mechanosensitive channel

SCOP Domain Sequences for d2oaue3:

Sequence; same for both SEQRES and ATOM records:

>d2oaue3 f.34.1.1 (E:27-112) Mechanosensitive channel protein MscS (YggB), transmembrane region {Escherichia coli [TaxId: 562]}
yavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaal
grvgvqtasviavlgaaglavglalq

Timeline for d2oaue3:

• d2oaue3 first appeared in SCOP 1.73
  
• d2oaue3 appears in SCOPe 2.01
  
• d2oaue3 appears in the current release, SCOPe 2.08