SCOPe 2.07: Domain d2oauc1: 2oau C:113-179

Lineage for d2oauc1 (2oau C:113-179)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.3: Mechanosensitive channel protein MscS (YggB), middle domain [82090] (1 protein)

6. Protein Mechanosensitive channel protein MscS (YggB), middle domain [82091] (1 species)
   forms homoheptameric ring structure very similar to those of the archaeal and eukaryotic Sm proteins

7. Species Escherichia coli [TaxId:562] [82092] (2 PDB entries)

8. Domain d2oauc1: 2oau C:113-179 [138984]
   Other proteins in same PDB: d2oaua2, d2oaua3, d2oaub2, d2oaub3, d2oauc2, d2oauc3, d2oaud2, d2oaud3, d2oaue2, d2oaue3, d2oauf2, d2oauf3, d2oaug2, d2oaug3
   automatically matched to d1mxma1

Details for d2oauc1

PDB Entry: 2oau, 3.7 Å

PDB Description: Mechanosensitive Channel of Small Conductance (MscS)

PDB Compounds: (C:) Small-conductance mechanosensitive channel

SCOPe Domain Sequences for d2oauc1:

Sequence; same for both SEQRES and ATOM records:

>d2oauc1 b.38.1.3 (C:113-179) Mechanosensitive channel protein MscS (YggB), middle domain {Escherichia coli [TaxId: 562]}
gslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiia
gniinfs

Timeline for d2oauc1:

• d2oauc1 first appeared in SCOP 1.73
  
• d2oauc1 appears in SCOPe 2.06
  
• d2oauc1 appears in the current release, SCOPe 2.08