Lineage for d2oard1 (2oar D:1-118)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023850Fold f.16: Gated mechanosensitive channel [81331] (1 superfamily)
    oligomeric transmembrane alpha-helical protein
  4. 3023851Superfamily f.16.1: Gated mechanosensitive channel [81330] (1 family) (S)
    automatically mapped to Pfam PF01741
  5. 3023852Family f.16.1.1: Gated mechanosensitive channel [81329] (1 protein)
  6. 3023853Protein Gated mechanosensitive channel [56904] (1 species)
    Large-conductance ion channel
  7. 3023854Species Mycobacterium tuberculosis [TaxId:1773] [56905] (1 PDB entry)
  8. 3023858Domain d2oard1: 2oar D:1-118 [138976]
    automatically matched to d1msla_
    complexed with au

Details for d2oard1

PDB Entry: 2oar (more details), 3.5 Å

PDB Description: Mechanosensitive Channel of Large Conductance (MscL)
PDB Compounds: (D:) Large-conductance mechanosensitive channel

SCOPe Domain Sequences for d2oard1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oard1 f.16.1.1 (D:1-118) Gated mechanosensitive channel {Mycobacterium tuberculosis [TaxId: 1773]}
mlkgfkeflargnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrig
igggqtidlnvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir

SCOPe Domain Coordinates for d2oard1:

Click to download the PDB-style file with coordinates for d2oard1.
(The format of our PDB-style files is described here.)

Timeline for d2oard1: