![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.16: Gated mechanosensitive channel [81331] (1 superfamily) oligomeric transmembrane alpha-helical protein |
![]() | Superfamily f.16.1: Gated mechanosensitive channel [81330] (1 family) ![]() automatically mapped to Pfam PF01741 |
![]() | Family f.16.1.1: Gated mechanosensitive channel [81329] (1 protein) |
![]() | Protein Gated mechanosensitive channel [56904] (1 species) Large-conductance ion channel |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [56905] (1 PDB entry) |
![]() | Domain d2oarc1: 2oar C:1-118 [138975] automatically matched to d1msla_ complexed with au |
PDB Entry: 2oar (more details), 3.5 Å
SCOPe Domain Sequences for d2oarc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oarc1 f.16.1.1 (C:1-118) Gated mechanosensitive channel {Mycobacterium tuberculosis [TaxId: 1773]} mlkgfkeflargnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrig igggqtidlnvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir
Timeline for d2oarc1:
![]() Domains from other chains: (mouse over for more information) d2oara1, d2oarb1, d2oard1, d2oare1 |