SCOPe 2.05: Domain d2oara1: 2oar A:10-118

Lineage for d2oara1 (2oar A:10-118)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.16: Gated mechanosensitive channel [81331] (1 superfamily)
   oligomeric transmembrane alpha-helical protein

4. Superfamily f.16.1: Gated mechanosensitive channel [81330] (1 family)
   automatically mapped to Pfam PF01741

5. Family f.16.1.1: Gated mechanosensitive channel [81329] (1 protein)

6. Protein Gated mechanosensitive channel [56904] (1 species)
   Large-conductance ion channel

7. Species Mycobacterium tuberculosis [TaxId:1773] [56905] (1 PDB entry)

8. Domain d2oara1: 2oar A:10-118 [138973]
   automatically matched to d1msla_
   complexed with au

Details for d2oara1

PDB Entry: 2oar, 3.5 Å

PDB Description: Mechanosensitive Channel of Large Conductance (MscL)

PDB Compounds: (A:) Large-conductance mechanosensitive channel

SCOPe Domain Sequences for d2oara1:

Sequence; same for both SEQRES and ATOM records:

>d2oara1 f.16.1.1 (A:10-118) Gated mechanosensitive channel {Mycobacterium tuberculosis [TaxId: 1773]}
argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl
nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir

Timeline for d2oara1:

• d2oara1 first appeared in SCOP 1.73
  
• d2oara1 appears in SCOPe 2.04
  
• d2oara1 appears in SCOPe 2.06
  
• d2oara1 appears in the current release, SCOPe 2.08