Lineage for d2oadb2 (2oad B:1-78)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879989Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries)
  8. 2880006Domain d2oadb2: 2oad B:1-78 [138972]
    Other proteins in same PDB: d2oada1, d2oadb1
    automated match to d2j9ha1
    complexed with gtb; mutant

Details for d2oadb2

PDB Entry: 2oad (more details), 2.5 Å

PDB Description: structure of glutathione-s-transferase c169a mutant
PDB Compounds: (B:) Glutathione S-transferase P 1

SCOPe Domain Sequences for d2oadb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oadb2 c.47.1.0 (B:1-78) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

SCOPe Domain Coordinates for d2oadb2:

Click to download the PDB-style file with coordinates for d2oadb2.
(The format of our PDB-style files is described here.)

Timeline for d2oadb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oadb1