SCOPe 2.08: Domain d2oadb2: 2oad B:1-78

Lineage for d2oadb2 (2oad B:1-78)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225046] (14 PDB entries)

8. Domain d2oadb2: 2oad B:1-78 [138972]
   Other proteins in same PDB: d2oada1, d2oadb1
   automated match to d2j9ha1
   complexed with gtb; mutant

Details for d2oadb2

PDB Entry: 2oad, 2.5 Å

PDB Description: structure of glutathione-s-transferase c169a mutant

PDB Compounds: (B:) Glutathione S-transferase P 1

SCOPe Domain Sequences for d2oadb2:

Sequence; same for both SEQRES and ATOM records:

>d2oadb2 c.47.1.0 (B:1-78) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

Timeline for d2oadb2:

• d2oadb2 first appeared in SCOP 1.73
  
• d2oadb2 appears in SCOPe 2.07