SCOPe 2.06: Domain d2oaca1: 2oac A:79-209

Lineage for d2oaca1 (2oac A:79-209)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47621] (10 PDB entries)

8. Domain d2oaca1: 2oac A:79-209 [138965]
   Other proteins in same PDB: d2oaca2, d2oacb2
   automated match to d1gssa1
   complexed with gtb; mutant

Details for d2oaca1

PDB Entry: 2oac, 2.2 Å

PDB Description: mouse c14a glutathione-s-transferase mutant in complex with s-(p- nitrobenzyl) glutathione

PDB Compounds: (A:) Glutathione S-transferase P 1

SCOPe Domain Sequences for d2oaca1:

Sequence; same for both SEQRES and ATOM records:

>d2oaca1 a.45.1.1 (A:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

Timeline for d2oaca1:

• d2oaca1 first appeared in SCOP 1.73
  
• d2oaca1 appears in SCOPe 2.05
  
• d2oaca1 appears in SCOPe 2.07
  
• d2oaca1 appears in the current release, SCOPe 2.08