SCOP 1.73: Domain d2oa7b1: 2oa7 B:79-209

Lineage for d2oa7b1 (2oa7 B:79-209)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47621] (9 PDB entries)

8. Domain d2oa7b1: 2oa7 B:79-209 [138963]
   Other proteins in same PDB: d2oa7a2, d2oa7b2
   automatically matched to d1baya1
   complexed with gtx; mutant

Details for d2oa7b1

PDB Entry: 2oa7, 2.2 Å

PDB Description: mouse c14a glutathione-s-transferase mutant in complex with s-hexyl glutathione

PDB Compounds: (B:) Glutathione S-transferase P 1

SCOP Domain Sequences for d2oa7b1:

Sequence; same for both SEQRES and ATOM records:

>d2oa7b1 a.45.1.1 (B:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

Timeline for d2oa7b1:

• d2oa7b1 is new in SCOP 1.73
  
• d2oa7b1 appears in SCOP 1.75
  
• d2oa7b1 appears in the current release, SCOPe 2.08