Lineage for d2o9ux_ (2o9u X:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2180922Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2180923Family d.17.1.1: Monellin [54404] (2 proteins)
  6. 2180946Protein automated matches [190339] (1 species)
    not a true protein
  7. 2180947Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [187163] (5 PDB entries)
  8. 2180948Domain d2o9ux_: 2o9u X: [138960]
    automated match to d1m9ga_
    complexed with so4

Details for d2o9ux_

PDB Entry: 2o9u (more details), 1.15 Å

PDB Description: monellin (mnei) at 1.15 resolution
PDB Compounds: (X:) Monellin chain B and Monellin chain A

SCOPe Domain Sequences for d2o9ux_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o9ux_ d.17.1.1 (X:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
qlyvyasdklfradisedyktrgrkllrfngpvppp

SCOPe Domain Coordinates for d2o9ux_:

Click to download the PDB-style file with coordinates for d2o9ux_.
(The format of our PDB-style files is described here.)

Timeline for d2o9ux_: