Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.1: Monellin [54404] (2 proteins) |
Protein automated matches [190339] (1 species) not a true protein |
Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [187163] (5 PDB entries) |
Domain d2o9ux_: 2o9u X: [138960] automated match to d1m9ga_ complexed with so4 |
PDB Entry: 2o9u (more details), 1.15 Å
SCOPe Domain Sequences for d2o9ux_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o9ux_ d.17.1.1 (X:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]} geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey qlyvyasdklfradisedyktrgrkllrfngpvppp
Timeline for d2o9ux_: