![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.2: GAF domain-like [55781] (5 families) ![]() alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
![]() | Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins) Pfam PF01614 |
![]() | Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [111112] (3 PDB entries) Uniprot P16528 98-272 |
![]() | Domain d2o9ad2: 2o9a D:4-180 [138959] Other proteins in same PDB: d2o9aa3, d2o9aa4, d2o9ab3, d2o9ac3, d2o9ac4, d2o9ad3 automated match to d1td5d_ protein/DNA complex; complexed with edo, pyr |
PDB Entry: 2o9a (more details), 1.8 Å
SCOPe Domain Sequences for d2o9ad2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o9ad2 d.110.2.2 (D:4-180) Transcriptional regulator IclR, C-terminal domain {Escherichia coli [TaxId: 562]} srnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggklpmh asgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfddeeha lglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggmr
Timeline for d2o9ad2: