Lineage for d2o9ac2 (2o9a C:4-180)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970201Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
    Pfam PF01614
  6. 2970208Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species)
  7. 2970209Species Escherichia coli [TaxId:562] [111112] (3 PDB entries)
    Uniprot P16528 98-272
  8. 2970212Domain d2o9ac2: 2o9a C:4-180 [138958]
    Other proteins in same PDB: d2o9aa3, d2o9aa4, d2o9ab3, d2o9ac3, d2o9ac4, d2o9ad3
    automated match to d1td5d_
    protein/DNA complex; complexed with edo, pyr

Details for d2o9ac2

PDB Entry: 2o9a (more details), 1.8 Å

PDB Description: The crystal structure of the E.coli IclR C-terminal fragment in complex with pyruvate.
PDB Compounds: (C:) Acetate operon repressor

SCOPe Domain Sequences for d2o9ac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o9ac2 d.110.2.2 (C:4-180) Transcriptional regulator IclR, C-terminal domain {Escherichia coli [TaxId: 562]}
srnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggklpmh
asgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfddeeha
lglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggmr

SCOPe Domain Coordinates for d2o9ac2:

Click to download the PDB-style file with coordinates for d2o9ac2.
(The format of our PDB-style files is described here.)

Timeline for d2o9ac2: