Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.110: Profilin-like [55769] (9 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (3 families) alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins) Pfam PF01614 |
Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species) |
Species Escherichia coli [TaxId:562] [111112] (3 PDB entries) |
Domain d2o9ab1: 2o9a B:1-179 [138957] automatically matched to d1td5d_ complexed with edo, pyr |
PDB Entry: 2o9a (more details), 1.8 Å
SCOP Domain Sequences for d2o9ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o9ab1 d.110.2.2 (B:1-179) Transcriptional regulator IclR, C-terminal domain {Escherichia coli [TaxId: 562]} ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggm
Timeline for d2o9ab1: