Lineage for d2o9ab1 (2o9a B:1-179)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731578Fold d.110: Profilin-like [55769] (9 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 731620Superfamily d.110.2: GAF domain-like [55781] (3 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 731634Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
    Pfam PF01614
  6. 731641Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species)
  7. 731642Species Escherichia coli [TaxId:562] [111112] (3 PDB entries)
  8. 731644Domain d2o9ab1: 2o9a B:1-179 [138957]
    automatically matched to d1td5d_
    complexed with edo, pyr

Details for d2o9ab1

PDB Entry: 2o9a (more details), 1.8 Å

PDB Description: The crystal structure of the E.coli IclR C-terminal fragment in complex with pyruvate.
PDB Compounds: (B:) Acetate operon repressor

SCOP Domain Sequences for d2o9ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o9ab1 d.110.2.2 (B:1-179) Transcriptional regulator IclR, C-terminal domain {Escherichia coli [TaxId: 562]}
ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde
ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggm

SCOP Domain Coordinates for d2o9ab1:

Click to download the PDB-style file with coordinates for d2o9ab1.
(The format of our PDB-style files is described here.)

Timeline for d2o9ab1: