Lineage for d2o99c_ (2o99 C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665312Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1665377Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 1665444Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
    Pfam PF01614
  6. 1665451Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species)
  7. 1665452Species Escherichia coli [TaxId:562] [111112] (3 PDB entries)
    Uniprot P16528 98-272
  8. 1665459Domain d2o99c_: 2o99 C: [138954]
    automated match to d1td5d_
    protein/DNA complex; complexed with edo, goa

Details for d2o99c_

PDB Entry: 2o99 (more details), 1.7 Å

PDB Description: The crystal structure of E.coli IclR C-terminal fragment in complex with glyoxylate
PDB Compounds: (C:) Acetate operon repressor

SCOPe Domain Sequences for d2o99c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o99c_ d.110.2.2 (C:) Transcriptional regulator IclR, C-terminal domain {Escherichia coli [TaxId: 562]}
ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde
ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggmr
gs

SCOPe Domain Coordinates for d2o99c_:

Click to download the PDB-style file with coordinates for d2o99c_.
(The format of our PDB-style files is described here.)

Timeline for d2o99c_: