SCOP 1.73: Domain d2o99c1: 2o99 C:1-180

Lineage for d2o99c1 (2o99 C:1-180)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.110: Profilin-like [55769] (9 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (3 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
   Pfam PF01614

6. Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species)

7. Species Escherichia coli [TaxId:562] [111112] (3 PDB entries)

8. Domain d2o99c1: 2o99 C:1-180 [138954]
   automatically matched to d1td5d_
   complexed with edo, goa

Details for d2o99c1

PDB Entry: 2o99, 1.7 Å

PDB Description: The crystal structure of E.coli IclR C-terminal fragment in complex with glyoxylate

PDB Compounds: (C:) Acetate operon repressor

SCOP Domain Sequences for d2o99c1:

Sequence; same for both SEQRES and ATOM records:

>d2o99c1 d.110.2.2 (C:1-180) Transcriptional regulator IclR, C-terminal domain {Escherichia coli [TaxId: 562]}
ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde
ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggmr

Timeline for d2o99c1:

• d2o99c1 is new in SCOP 1.73
  
• d2o99c1 appears in SCOP 1.75
  
• d2o99c1 appears in the current release, SCOPe 2.08, called d2o99c2