Lineage for d2o99c2 (2o99 C:4-180)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970201Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
    Pfam PF01614
  6. 2970208Protein Transcriptional regulator IclR, C-terminal domain [75514] (2 species)
  7. 2970209Species Escherichia coli [TaxId:562] [111112] (3 PDB entries)
    Uniprot P16528 98-272
  8. 2970216Domain d2o99c2: 2o99 C:4-180 [138954]
    Other proteins in same PDB: d2o99a3, d2o99a4, d2o99b3, d2o99c3, d2o99c4, d2o99d3
    automated match to d1td5d_
    protein/DNA complex; complexed with edo, goa

Details for d2o99c2

PDB Entry: 2o99 (more details), 1.7 Å

PDB Description: The crystal structure of E.coli IclR C-terminal fragment in complex with glyoxylate
PDB Compounds: (C:) Acetate operon repressor

SCOPe Domain Sequences for d2o99c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o99c2 d.110.2.2 (C:4-180) Transcriptional regulator IclR, C-terminal domain {Escherichia coli [TaxId: 562]}
srnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggklpmh
asgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfddeeha
lglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggmr

SCOPe Domain Coordinates for d2o99c2:

Click to download the PDB-style file with coordinates for d2o99c2.
(The format of our PDB-style files is described here.)

Timeline for d2o99c2: