SCOP 1.75: Domain d2o98b1: 2o98 B:5-240

Lineage for d2o98b1 (2o98 B:5-240)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)

5. Family a.118.7.1: 14-3-3 protein [48446] (4 proteins)

6. Protein 14-3-3-like protein C [89132] (1 species)

7. Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [89133] (5 PDB entries)

8. Domain d2o98b1: 2o98 B:5-240 [138951]
   automatically matched to d1o9ca_
   complexed with fsc, so4; mutant

Details for d2o98b1

PDB Entry: 2o98, 2.7 Å

PDB Description: structure of the 14-3-3 / h+-atpase plant complex

PDB Compounds: (B:) 14-3-3-like protein c

SCOP Domain Sequences for d2o98b1:

Sequence; same for both SEQRES and ATOM records:

>d2o98b1 a.118.7.1 (B:5-240) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}
ptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarra
swriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgdsk
vfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnfs
vfyyeilnspdracnlakqafdeaiaeldtlgeesykdstlimqllrdnltlwtsd

Timeline for d2o98b1:

• d2o98b1 first appeared in SCOP 1.73
  
• d2o98b1 is called d2o98b_ in SCOPe 2.01
  
• d2o98b1 appears in the current release, SCOPe 2.08, called d2o98b_