SCOP 1.73: Domain d2o97a1: 2o97 A:1-90

Lineage for d2o97a1 (2o97 A:1-90)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)

6. Protein HU protein [47735] (4 species)

7. Species Escherichia coli [TaxId:562] [101230] (2 PDB entries)

8. Domain d2o97a1: 2o97 A:1-90 [138949]
   automatically matched to d1mula_
   complexed with cl, ni

Details for d2o97a1

PDB Entry: 2o97, 2.45 Å

PDB Description: crystal structure of e. coli hu heterodimer

PDB Compounds: (A:) DNA-binding protein HU-alpha

SCOP Domain Sequences for d2o97a1:

Sequence, based on SEQRES records:

>d2o97a1 a.55.1.1 (A:1-90) HU protein {Escherichia coli [TaxId: 562]}
mnktqlidviaekaelsktqakaalestlaaiteslkegdavqlvgfgtfkvnhraertg
rnpqtgkeikiaaanvpafvsgkalkdavk

Sequence, based on observed residues (ATOM records):

>d2o97a1 a.55.1.1 (A:1-90) HU protein {Escherichia coli [TaxId: 562]}
mnktqlidviaekaelsktqakaalestlaaiteslkegdavqlvgfgtfkvnhnvpafv
sgkalkdavk

Timeline for d2o97a1:

• d2o97a1 is new in SCOP 1.73
  
• d2o97a1 appears in SCOP 1.75
  
• d2o97a1 appears in the current release, SCOPe 2.08, called d2o97a_