Lineage for d2o97a_ (2o97 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715143Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
    automatically mapped to Pfam PF00216
  6. 2715144Protein HU protein [47735] (5 species)
  7. 2715160Species Escherichia coli [TaxId:562] [101230] (2 PDB entries)
  8. 2715162Domain d2o97a_: 2o97 A: [138949]
    automated match to d1mula_
    complexed with cl, ni

Details for d2o97a_

PDB Entry: 2o97 (more details), 2.45 Å

PDB Description: crystal structure of e. coli hu heterodimer
PDB Compounds: (A:) DNA-binding protein HU-alpha

SCOPe Domain Sequences for d2o97a_:

Sequence, based on SEQRES records: (download)

>d2o97a_ a.55.1.1 (A:) HU protein {Escherichia coli [TaxId: 562]}
mnktqlidviaekaelsktqakaalestlaaiteslkegdavqlvgfgtfkvnhraertg
rnpqtgkeikiaaanvpafvsgkalkdavk

Sequence, based on observed residues (ATOM records): (download)

>d2o97a_ a.55.1.1 (A:) HU protein {Escherichia coli [TaxId: 562]}
mnktqlidviaekaelsktqakaalestlaaiteslkegdavqlvgfgtfkvnhnvpafv
sgkalkdavk

SCOPe Domain Coordinates for d2o97a_:

Click to download the PDB-style file with coordinates for d2o97a_.
(The format of our PDB-style files is described here.)

Timeline for d2o97a_: