SCOPe 2.05: Domain d2o93o2: 2o93 O:392-575

Lineage for d2o93o2 (2o93 O:392-575)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
   automatically mapped to Pfam PF00554

6. Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)

8. Domain d2o93o2: 2o93 O:392-575 [138948]
   Other proteins in same PDB: d2o93l1, d2o93m1, d2o93o1
   automated match to d2o93m2
   protein/DNA complex

Details for d2o93o2

PDB Entry: 2o93, 3.05 Å

PDB Description: crystal structure of nfat bound to the hiv-1 ltr tandem kappab enhancer element

PDB Compounds: (O:) actor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d2o93o2:

Sequence; same for both SEQRES and ATOM records:

>d2o93o2 b.2.5.3 (O:392-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
assvplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymen
kplglqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmra
tidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsq
rsah

Timeline for d2o93o2:

• d2o93o2 first appeared in SCOP 1.73
  
• d2o93o2 appears in SCOPe 2.04
  
• d2o93o2 appears in SCOPe 2.06
  
• d2o93o2 appears in the current release, SCOPe 2.08