SCOPe 2.06: Domain d2o93o1: 2o93 O:576-678

Lineage for d2o93o1 (2o93 O:576-678)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)

8. Domain d2o93o1: 2o93 O:576-678 [138947]
   Other proteins in same PDB: d2o93l2, d2o93m2, d2o93m3, d2o93o2
   automated match to d1p7hl1
   protein/DNA complex

Details for d2o93o1

PDB Entry: 2o93, 3.05 Å

PDB Description: crystal structure of nfat bound to the hiv-1 ltr tandem kappab enhancer element

PDB Compounds: (O:) actor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d2o93o1:

Sequence; same for both SEQRES and ATOM records:

>d2o93o1 b.1.18.1 (O:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

Timeline for d2o93o1:

• d2o93o1 first appeared in SCOP 1.73
  
• d2o93o1 appears in SCOPe 2.05
  
• d2o93o1 appears in SCOPe 2.07
  
• d2o93o1 appears in the current release, SCOPe 2.08