Lineage for d2o93o1 (2o93 O:576-678)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 788951Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 789029Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)
  7. 789030Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)
  8. 789039Domain d2o93o1: 2o93 O:576-678 [138947]
    Other proteins in same PDB: d2o93l2, d2o93m2, d2o93o2
    automatically matched to d1owrm1

Details for d2o93o1

PDB Entry: 2o93 (more details), 3.05 Å

PDB Description: crystal structure of nfat bound to the hiv-1 ltr tandem kappab enhancer element
PDB Compounds: (O:) actor of activated T-cells, cytoplasmic 2

SCOP Domain Sequences for d2o93o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o93o1 b.1.18.1 (O:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

SCOP Domain Coordinates for d2o93o1:

Click to download the PDB-style file with coordinates for d2o93o1.
(The format of our PDB-style files is described here.)

Timeline for d2o93o1: