Class b: All beta proteins [48724] (165 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (7 families) |
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins) |
Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries) |
Domain d2o93m2: 2o93 M:395-575 [138946] Other proteins in same PDB: d2o93l1, d2o93m1, d2o93o1 automatically matched to d1p7hl2 |
PDB Entry: 2o93 (more details), 3.05 Å
SCOP Domain Sequences for d2o93m2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o93m2 b.2.5.3 (M:395-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} vplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkpl glqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratid cagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsa h
Timeline for d2o93m2:
View in 3D Domains from other chains: (mouse over for more information) d2o93l1, d2o93l2, d2o93o1, d2o93o2 |