| Class b: All beta proteins [48724] (177 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
| Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins) automatically mapped to Pfam PF00554 |
| Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries) |
| Domain d2o93l2: 2o93 L:392-575 [138944] Other proteins in same PDB: d2o93l1, d2o93m1, d2o93m3, d2o93o1 automated match to d2o93m2 protein/DNA complex |
PDB Entry: 2o93 (more details), 3.05 Å
SCOPe Domain Sequences for d2o93l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o93l2 b.2.5.3 (L:392-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
assvplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymen
kplglqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmra
tidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsq
rsah
Timeline for d2o93l2: