Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (23 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins) subgroup of the larger IPT/TIG domain family |
Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries) |
Domain d2o93l1: 2o93 L:576-678 [138943] Other proteins in same PDB: d2o93l2, d2o93m2, d2o93o2 automatically matched to d1owrm1 |
PDB Entry: 2o93 (more details), 3.05 Å
SCOP Domain Sequences for d2o93l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o93l1 b.1.18.1 (L:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]} elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
Timeline for d2o93l1:
View in 3D Domains from other chains: (mouse over for more information) d2o93m1, d2o93m2, d2o93o1, d2o93o2 |