Lineage for d2o92a2 (2o92 A:240-307)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548924Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2548925Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2549079Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 2549093Species Goat (Capra hircus) [TaxId:9925] [89883] (14 PDB entries)
  8. 2549107Domain d2o92a2: 2o92 A:240-307 [138942]
    Other proteins in same PDB: d2o92a1
    automatically matched to d1ljya2
    complexed with man, nag

Details for d2o92a2

PDB Entry: 2o92 (more details), 3 Å

PDB Description: crystal structure of a signalling protein (spg-40) complex with tetrasaccharide at 3.0a resolution
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d2o92a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o92a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
fgrsftlassktdvgapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

SCOPe Domain Coordinates for d2o92a2:

Click to download the PDB-style file with coordinates for d2o92a2.
(The format of our PDB-style files is described here.)

Timeline for d2o92a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o92a1