Lineage for d2o8rb4 (2o8r B:506-690)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216700Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 2216701Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 2216818Family d.136.1.4: Polyphosphate kinase C-terminal domain [143860] (1 protein)
    C-terminal part of Pfam PF02503; similar to PLD; contains two domains of this fold arranged as in the Nuc dimer
  6. 2216819Protein Polyphosphate kinase, PPK [143861] (2 species)
  7. 2216829Species Porphyromonas gingivalis [TaxId:837] [143862] (1 PDB entry)
    Uniprot Q7MTR1 318-505! Uniprot Q7MTR1 506-691
  8. 2216833Domain d2o8rb4: 2o8r B:506-690 [138940]
    Other proteins in same PDB: d2o8ra1, d2o8ra2, d2o8rb1, d2o8rb2
    automated match to d2o8ra4
    complexed with so4

Details for d2o8rb4

PDB Entry: 2o8r (more details), 2.7 Å

PDB Description: crystal structure of polyphosphate kinase from porphyromonas gingivalis
PDB Compounds: (B:) Polyphosphate kinase

SCOPe Domain Sequences for d2o8rb4:

Sequence, based on SEQRES records: (download)

>d2o8rb4 d.136.1.4 (B:506-690) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]}
rllvarynmgeaitnliereienvkrgkrgymllkmnglqdknvitqlyraseagveidl
ivrgicclvpdmpqsrnirvtrlvdmylehsriwcfhnggkeevfissadwmkrnlynri
etacpvldptlrreiidileiqlrdnikacridsslnniykhnsdekpvraqaaiyrylk
gkeet

Sequence, based on observed residues (ATOM records): (download)

>d2o8rb4 d.136.1.4 (B:506-690) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]}
rllvarynmgeaitnliereienvkrgkrgymllkmnglqdknvitqlyraseagveidl
ivrgicclvpdmpqsrnirvtrlvdmylehsriwcfhnggkeevfissadwlynrietac
pvldptlrreiidileiqlrdnikaciykhnsdekpvraqaaiyrylkgkeet

SCOPe Domain Coordinates for d2o8rb4:

Click to download the PDB-style file with coordinates for d2o8rb4.
(The format of our PDB-style files is described here.)

Timeline for d2o8rb4: