Lineage for d2o8rb3 (2o8r B:318-505)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734041Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 734042Superfamily d.136.1: Phospholipase D/nuclease [56024] (4 families) (S)
  5. 734125Family d.136.1.4: Polyphosphate kinase C-terminal domain [143860] (1 protein)
    C-terminal part of Pfam PF02503; similar to PLD; contains two domains of this fold arranged as in the Nuc dimer
  6. 734126Protein Polyphosphate kinase, PPK [143861] (2 species)
  7. 734136Species Porphyromonas gingivalis [TaxId:837] [143862] (1 PDB entry)
  8. 734139Domain d2o8rb3: 2o8r B:318-505 [138939]
    Other proteins in same PDB: d2o8ra1, d2o8ra2, d2o8rb1, d2o8rb2
    automatically matched to 2O8R A:318-505
    complexed with so4; mutant

Details for d2o8rb3

PDB Entry: 2o8r (more details), 2.7 Å

PDB Description: crystal structure of polyphosphate kinase from porphyromonas gingivalis
PDB Compounds: (B:) Polyphosphate kinase

SCOP Domain Sequences for d2o8rb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o8rb3 d.136.1.4 (B:318-505) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]}
ltpepllskhleqapslmegirrkdylihvpyytydyvvrllmeaaispdvseirltqyr
vaenssiisaleaaaqsgkkvsvfvelkarfdeennlrlsermrrsgirivysmpglkvh
aktalilyhtpagerpqgiallstgnfnettariysdttlmtantdivhdvyrlfrildg
dpeparfs

SCOP Domain Coordinates for d2o8rb3:

Click to download the PDB-style file with coordinates for d2o8rb3.
(The format of our PDB-style files is described here.)

Timeline for d2o8rb3: