Lineage for d2o8rb2 (2o8r B:113-317)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616710Fold d.322: PHP14-like [143723] (1 superfamily)
    beta(3)-alpha-beta(2)-alpha-beta; 3 layers, a/b/a; mixed beta-sheet, half-barrel, order: 132456; strands 2 and 5 are antiparallel to the rest
  4. 2616711Superfamily d.322.1: PHP14-like [143724] (2 families) (S)
  5. 2616722Family d.322.1.2: PPK middle domain-like [143728] (1 protein)
    central part of Pfam PF02503
  6. 2616723Protein Polyphosphate kinase, PPK [143729] (2 species)
  7. 2616729Species Porphyromonas gingivalis [TaxId:837] [143730] (1 PDB entry)
    Uniprot Q7MTR1 113-317
  8. 2616731Domain d2o8rb2: 2o8r B:113-317 [138938]
    Other proteins in same PDB: d2o8ra1, d2o8ra3, d2o8ra4, d2o8rb1, d2o8rb3, d2o8rb4
    automated match to d2o8ra2
    complexed with so4

Details for d2o8rb2

PDB Entry: 2o8r (more details), 2.7 Å

PDB Description: crystal structure of polyphosphate kinase from porphyromonas gingivalis
PDB Compounds: (B:) Polyphosphate kinase

SCOPe Domain Sequences for d2o8rb2:

Sequence, based on SEQRES records: (download)

>d2o8rb2 d.322.1.2 (B:113-317) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]}
irlrthapthpdhkaylrrffheeifpllypmlllpskvrtfirsgrvylavrlkeketd
eaysyallnvptdglprfvelprlqtdtfyyysflediikehldvvfpgyevmdsysikv
srdadllldaqrpedlpgeirkkvktrklgaptrfmydgrmpdevlryicsscdidpeea
irsgnyvnlqdlamlpnpfaprlet

Sequence, based on observed residues (ATOM records): (download)

>d2o8rb2 d.322.1.2 (B:113-317) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]}
irlrthapthpdhkaylrrffheeifpllypmlllpskvrtfirsgrvylavrlkeketd
eaysyallnvptdglprfvelprlqtdtfyyysflediikehldvvfpgyevmdsysikv
srptrfmydgrmpdevlryiairsgnyvnlqdlamlpnpfaprlet

SCOPe Domain Coordinates for d2o8rb2:

Click to download the PDB-style file with coordinates for d2o8rb2.
(The format of our PDB-style files is described here.)

Timeline for d2o8rb2: