SCOP 1.75: Domain d2o8rb2: 2o8r B:113-317

Lineage for d2o8rb2 (2o8r B:113-317)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.322: PHP14-like [143723] (1 superfamily)
   beta(3)-alpha-beta(2)-alpha-beta; 3 layers, a/b/a; mixed beta-sheet, half-barrel, order: 132456; strands 2 and 5 are antiparallel to the rest

4. Superfamily d.322.1: PHP14-like [143724] (2 families)

5. Family d.322.1.2: PPK middle domain-like [143728] (1 protein)
   central part of Pfam PF02503

6. Protein Polyphosphate kinase, PPK [143729] (2 species)

7. Species Porphyromonas gingivalis [TaxId:837] [143730] (1 PDB entry)
   Uniprot Q7MTR1 113-317

8. Domain d2o8rb2: 2o8r B:113-317 [138938]
   Other proteins in same PDB: d2o8ra1, d2o8ra3, d2o8ra4, d2o8rb1, d2o8rb3, d2o8rb4
   automatically matched to 2O8R A:113-317
   complexed with so4; mutant

Details for d2o8rb2

PDB Entry: 2o8r, 2.7 Å

PDB Description: crystal structure of polyphosphate kinase from porphyromonas gingivalis

PDB Compounds: (B:) Polyphosphate kinase

SCOP Domain Sequences for d2o8rb2:

Sequence, based on SEQRES records:

>d2o8rb2 d.322.1.2 (B:113-317) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]}
irlrthapthpdhkaylrrffheeifpllypmlllpskvrtfirsgrvylavrlkeketd
eaysyallnvptdglprfvelprlqtdtfyyysflediikehldvvfpgyevmdsysikv
srdadllldaqrpedlpgeirkkvktrklgaptrfmydgrmpdevlryicsscdidpeea
irsgnyvnlqdlamlpnpfaprlet

Sequence, based on observed residues (ATOM records):

>d2o8rb2 d.322.1.2 (B:113-317) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]}
irlrthapthpdhkaylrrffheeifpllypmlllpskvrtfirsgrvylavrlkeketd
eaysyallnvptdglprfvelprlqtdtfyyysflediikehldvvfpgyevmdsysikv
srptrfmydgrmpdevlryiairsgnyvnlqdlamlpnpfaprlet

Timeline for d2o8rb2:

• d2o8rb2 first appeared in SCOP 1.73
  
• d2o8rb2 appears in SCOPe 2.01
  
• d2o8rb2 appears in the current release, SCOPe 2.08