Lineage for d2o8rb1 (2o8r B:11-112)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2310288Superfamily a.7.15: PPK N-terminal domain-like [140356] (1 family) (S)
    automatically mapped to Pfam PF13089
  5. 2310289Family a.7.15.1: PPK N-terminal domain-like [140357] (1 protein)
    N-terminal part of Pfam PF02503
    this is a repeat family; one repeat unit is 2o8r B:11-112 found in domain
  6. 2310290Protein Polyphosphate kinase, PPK [140358] (2 species)
  7. 2310296Species Porphyromonas gingivalis [TaxId:837] [140360] (1 PDB entry)
    Uniprot Q7MTR1 4-112
  8. 2310298Domain d2o8rb1: 2o8r B:11-112 [138937]
    Other proteins in same PDB: d2o8ra2, d2o8ra3, d2o8ra4, d2o8rb2, d2o8rb3, d2o8rb4
    automated match to d2o8ra1
    complexed with so4

Details for d2o8rb1

PDB Entry: 2o8r (more details), 2.7 Å

PDB Description: crystal structure of polyphosphate kinase from porphyromonas gingivalis
PDB Compounds: (B:) Polyphosphate kinase

SCOPe Domain Sequences for d2o8rb1:

Sequence, based on SEQRES records: (download)

>d2o8rb1 a.7.15.1 (B:11-112) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]}
rdmswlsfnervlmeaadrtlpvydrikflsifssnleefytvrvayhqavlqkrrdrse
aeedsdadahilqairetvirqdelyyrifydqilptleehg

Sequence, based on observed residues (ATOM records): (download)

>d2o8rb1 a.7.15.1 (B:11-112) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]}
rdmswlsfnervlmeaadrtlpvydrikflsifssnleefytvrvaylqairetvirqde
lyyrifydqilptleehg

SCOPe Domain Coordinates for d2o8rb1:

Click to download the PDB-style file with coordinates for d2o8rb1.
(The format of our PDB-style files is described here.)

Timeline for d2o8rb1: