![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.15: PPK N-terminal domain-like [140356] (1 family) ![]() automatically mapped to Pfam PF13089 |
![]() | Family a.7.15.1: PPK N-terminal domain-like [140357] (1 protein) N-terminal part of Pfam PF02503 this is a repeat family; one repeat unit is 2o8r B:11-112 found in domain |
![]() | Protein Polyphosphate kinase, PPK [140358] (2 species) |
![]() | Species Porphyromonas gingivalis [TaxId:837] [140360] (1 PDB entry) Uniprot Q7MTR1 4-112 |
![]() | Domain d2o8rb1: 2o8r B:11-112 [138937] Other proteins in same PDB: d2o8ra2, d2o8ra3, d2o8ra4, d2o8rb2, d2o8rb3, d2o8rb4 automated match to d2o8ra1 complexed with so4 |
PDB Entry: 2o8r (more details), 2.7 Å
SCOPe Domain Sequences for d2o8rb1:
Sequence, based on SEQRES records: (download)
>d2o8rb1 a.7.15.1 (B:11-112) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]} rdmswlsfnervlmeaadrtlpvydrikflsifssnleefytvrvayhqavlqkrrdrse aeedsdadahilqairetvirqdelyyrifydqilptleehg
>d2o8rb1 a.7.15.1 (B:11-112) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]} rdmswlsfnervlmeaadrtlpvydrikflsifssnleefytvrvaylqairetvirqde lyyrifydqilptleehg
Timeline for d2o8rb1:
![]() Domains from other chains: (mouse over for more information) d2o8ra1, d2o8ra2, d2o8ra3, d2o8ra4 |