Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.322: PHP14-like [143723] (1 superfamily) beta(3)-alpha-beta(2)-alpha-beta; 3 layers, a/b/a; mixed beta-sheet, half-barrel, order: 132456; strands 2 and 5 are antiparallel to the rest |
Superfamily d.322.1: PHP14-like [143724] (2 families) |
Family d.322.1.2: PPK middle domain-like [143728] (1 protein) central part of Pfam PF02503 |
Protein Polyphosphate kinase, PPK [143729] (2 species) |
Species Porphyromonas gingivalis [TaxId:837] [143730] (1 PDB entry) Uniprot Q7MTR1 113-317 |
Domain d2o8ra2: 2o8r A:113-317 [138934] Other proteins in same PDB: d2o8ra1, d2o8ra3, d2o8ra4, d2o8rb1, d2o8rb3, d2o8rb4 complexed with so4 |
PDB Entry: 2o8r (more details), 2.7 Å
SCOPe Domain Sequences for d2o8ra2:
Sequence, based on SEQRES records: (download)
>d2o8ra2 d.322.1.2 (A:113-317) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]} irlrthapthpdhkaylrrffheeifpllypmlllpskvrtfirsgrvylavrlkeketd eaysyallnvptdglprfvelprlqtdtfyyysflediikehldvvfpgyevmdsysikv srdadllldaqrpedlpgeirkkvktrklgaptrfmydgrmpdevlryicsscdidpeea irsgnyvnlqdlamlpnpfaprlet
>d2o8ra2 d.322.1.2 (A:113-317) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]} irlrthapthpdhkaylrrffheeifpllypmlllpskvrtfirsgrvylavrlkeketd eaysyallnvptdglprfvelprlqtdtfyyysflediikehldvvfpgyevmdsysikv srdadllldaptrfmydgrmpdevlryicsscdidpeeairsgnyvnlqdlamlpnpfap rlet
Timeline for d2o8ra2:
View in 3D Domains from other chains: (mouse over for more information) d2o8rb1, d2o8rb2, d2o8rb3, d2o8rb4 |