SCOP 1.73: Domain d2o8la1: 2o8l A:1-216

Lineage for d2o8la1 (2o8l A:1-216)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (15 proteins)

6. Protein V8 protease [101809] (1 species)
   glutamic acid-specific protease

7. Species Staphylococcus aureus [TaxId:1280] [101810] (3 PDB entries)

8. Domain d2o8la1: 2o8l A:1-216 [138932]
   automatically matched to d1qy6a_
   complexed with k

Details for d2o8la1

PDB Entry: 2o8l, 1.5 Å

PDB Description: structure of v8 protease from staphylococcus aureus

PDB Compounds: (A:) V8 protease

SCOP Domain Sequences for d2o8la1:

Sequence; same for both SEQRES and ATOM records:

>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]}
vilpnndrhqitdttnghyapvtyiqveaptgtfiasgvvvgkdtlltnkhvvdathgdp
halkafpsainqdnypnggftaeqitkysgegdlaivkfspneqnkhigevvkpatmsnn
aetqtnqnitvtgypgdkpvatmweskgkitylkgeamqydlsttggnsgspvfneknev
igihwggvpnefngavfinenvrnflkqniedinfa

Timeline for d2o8la1:

• d2o8la1 is new in SCOP 1.73
  
• d2o8la1 appears in SCOP 1.75
  
• d2o8la1 appears in the current release, SCOPe 2.08, called d2o8la_