Lineage for d2o7la1 (2o7l A:93-272)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746737Fold f.51: Rhomboid-like [144090] (1 superfamily)
    6 transmembrane helices
  4. 746738Superfamily f.51.1: Rhomboid-like [144091] (1 family) (S)
  5. 746739Family f.51.1.1: Rhomboid-like [144092] (2 proteins)
    Pfam PF01694; transmembrane serine protease
  6. 746740Protein GlpG [144095] (1 species)
  7. 746741Species Escherichia coli [TaxId:562] [144096] (4 PDB entries)
  8. 746745Domain d2o7la1: 2o7l A:93-272 [138928]
    automatically matched to 2IC8 A:91-272
    complexed with bng

Details for d2o7la1

PDB Entry: 2o7l (more details), 2.5 Å

PDB Description: the open-cap conformation of glpg
PDB Compounds: (A:) Protein glpG

SCOP Domain Sequences for d2o7la1:

Sequence, based on SEQRES records: (download)

>d2o7la1 f.51.1.1 (A:93-272) GlpG {Escherichia coli [TaxId: 562]}
agpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmhil
fnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgyvw
lrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdslna

Sequence, based on observed residues (ATOM records): (download)

>d2o7la1 f.51.1.1 (A:93-272) GlpG {Escherichia coli [TaxId: 562]}
agpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmhil
fnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgyvw
lrgerdpqsgiylqrgliifaliwivagwfdlangahiaglavglamafvdslna

SCOP Domain Coordinates for d2o7la1:

Click to download the PDB-style file with coordinates for d2o7la1.
(The format of our PDB-style files is described here.)

Timeline for d2o7la1: