Lineage for d2o7la_ (2o7l A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028691Fold f.51: Rhomboid-like [144090] (1 superfamily)
    6 transmembrane helices
  4. 3028692Superfamily f.51.1: Rhomboid-like [144091] (2 families) (S)
  5. 3028693Family f.51.1.1: Rhomboid-like [144092] (3 proteins)
    Pfam PF01694; transmembrane serine protease
  6. 3028694Protein GlpG [144095] (1 species)
  7. 3028695Species Escherichia coli [TaxId:562] [144096] (19 PDB entries)
    Uniprot P09391 91-272
  8. 3028710Domain d2o7la_: 2o7l A: [138928]
    automated match to d2ic8a1
    complexed with bng

Details for d2o7la_

PDB Entry: 2o7l (more details), 2.5 Å

PDB Description: the open-cap conformation of glpg
PDB Compounds: (A:) Protein glpG

SCOPe Domain Sequences for d2o7la_:

Sequence, based on SEQRES records: (download)

>d2o7la_ f.51.1.1 (A:) GlpG {Escherichia coli [TaxId: 562]}
agpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmhil
fnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgyvw
lrgerdpqsgiylqrgliifaliwivagwfdlfgmsmangahiaglavglamafvdslna

Sequence, based on observed residues (ATOM records): (download)

>d2o7la_ f.51.1.1 (A:) GlpG {Escherichia coli [TaxId: 562]}
agpvtwvmmiacvvvfiamqilgdqevmlwlawpfdptlkfefwryfthalmhfslmhil
fnllwwwylggavekrlgsgklivitlisallsgyvqqkfsgpwfgglsgvvyalmgyvw
lrgerdpqsgiylqrgliifaliwivagwfdlangahiaglavglamafvdslna

SCOPe Domain Coordinates for d2o7la_:

Click to download the PDB-style file with coordinates for d2o7la_.
(The format of our PDB-style files is described here.)

Timeline for d2o7la_: