Lineage for d2o6vf1 (2o6v F:501-551)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 717214Protein Ubiquitin [54238] (3 species)
  7. 717220Species Human (Homo sapiens) [TaxId:9606] [54239] (47 PDB entries)
    identical sequence in many other species
  8. 717252Domain d2o6vf1: 2o6v F:501-551 [138926]
    automatically matched to d1gjza_
    complexed with mes, slz, so4; mutant

Details for d2o6vf1

PDB Entry: 2o6v (more details), 2.2 Å

PDB Description: crystal structure and solution nmr studies of lys48-linked tetraubiquitin at neutral ph
PDB Compounds: (F:) Ubiquitin

SCOP Domain Sequences for d2o6vf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6vf1 d.15.1.1 (F:501-551) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqle

SCOP Domain Coordinates for d2o6vf1:

Click to download the PDB-style file with coordinates for d2o6vf1.
(The format of our PDB-style files is described here.)

Timeline for d2o6vf1: