Lineage for d2o6ia1 (2o6i A:1-453)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014837Family a.211.1.1: HD domain [101340] (14 protein domains)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2014861Protein Hypothetical protein EF1143 [140767] (1 species)
    Probable ortholog of aq_1910
  7. 2014862Species Enterococcus faecalis [TaxId:1351] [140768] (4 PDB entries)
    Uniprot Q836G9 1-453
  8. 2014871Domain d2o6ia1: 2o6i A:1-453 [138920]
    Other proteins in same PDB: d2o6ib3
    complexed with cl, hed, zn

Details for d2o6ia1

PDB Entry: 2o6i (more details), 2.55 Å

PDB Description: structure of an enterococcus faecalis hd domain phosphohydrolase
PDB Compounds: (A:) HD domain protein

SCOPe Domain Sequences for d2o6ia1:

Sequence, based on SEQRES records: (download)

>d2o6ia1 a.211.1.1 (A:1-453) Hypothetical protein EF1143 {Enterococcus faecalis [TaxId: 1351]}
mtipykeqrlpiekvfrdpvhnyihvqhqvildlinsaevqrlrrikqlgtssftfhgae
hsrfshslgvyeitrriceifqrnysverlgengwndderlitlcaallhdvghgpysht
fehifdtnheaitvqiitspetevyqilnrvsadfpekvasvitkqypnpqvvqmissqi
dadrmdyllrdayftgteygtfdltrilrvirpykggiafamngmhavedyivsryqmyv
qvyfhpvsrgmevildhllhrakelfenpefdydlqasllvpffkgdftlqeylklddgv
lstyftqwmdvpdsilgdlakrflmrkplksatftnekesaatiaylreliekvgfnpky
ytainssydlpydfyrpnkdrhrtqielmqkdgslvelatvsplvaalagqsqgderfyf
pkemldqgnkkhydlfdetyrefssyihngalv

Sequence, based on observed residues (ATOM records): (download)

>d2o6ia1 a.211.1.1 (A:1-453) Hypothetical protein EF1143 {Enterococcus faecalis [TaxId: 1351]}
mtipykeqrlpiekvfrdpvhnyihvqhqvildlinsaevqrlrrikqlgtssftfhgae
hsrfshslgvyeitrriceifqrnysverlgengwndderlitlcaallhdvghgpysht
fehifdtnheaitvqiitspetevyqilnrvsadfpekvasvitkqypnpqvvqmissqi
dadrmdyllrdayftgteygtfdltrilrvirpykggiafamngmhavedyivsryqmyv
qvyfhpvsrgmevildhllhrakelfenpefdydlqasllvpffkgdftlqeylklddgv
lstyftqwmdvpdsilgdlakrflmrkplksatftnekesaatiaylreliekvgfnpky
ytainsslpydfyrrtqielmqkdgslvelatvsplvaalagqsqgderfyfpkemldfd
etyrefssyihngalv

SCOPe Domain Coordinates for d2o6ia1:

Click to download the PDB-style file with coordinates for d2o6ia1.
(The format of our PDB-style files is described here.)

Timeline for d2o6ia1: