Class b: All beta proteins [48724] (165 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (1 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (230 PDB entries) |
Domain d2o4kb1: 2o4k B:1-99 [138910] automatically matched to d3tlha_ complexed with cl, dr7; mutant |
PDB Entry: 2o4k (more details), 1.6 Å
SCOP Domain Sequences for d2o4kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o4kb1 b.50.1.1 (B:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} pqitlwkrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd qilieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d2o4kb1: