SCOPe 2.03: Domain d2o39c1: 2o39 C:1-62

Lineage for d2o39c1 (2o39 C:1-62)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
   Pfam PF00084

6. Protein CD46 (membrane cofactor protein, MCP) [57541] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57542] (2 PDB entries)

8. Domain d2o39c1: 2o39 C:1-62 [138898]
   Other proteins in same PDB: d2o39a1, d2o39b_
   automated match to d1ckla1
   complexed with ca

Details for d2o39c1

PDB Entry: 2o39, 2.85 Å

PDB Description: human adenovirus type 11 knob in complex with domains scr1 and scr2 of cd46 (membrane cofactor protein, mcp)

PDB Compounds: (C:) Membrane cofactor protein

SCOPe Domain Sequences for d2o39c1:

Sequence; same for both SEQRES and ATOM records:

>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]}
ceepptfeameligkpkpyyeigervdykckkgyfyipplathticdrnhtwlpvsddac
yr

Timeline for d2o39c1:

• d2o39c1 first appeared in SCOP 1.73
  
• d2o39c1 appears in SCOPe 2.02
  
• d2o39c1 appears in SCOPe 2.04
  
• d2o39c1 appears in the current release, SCOPe 2.08