Lineage for d2o2yc_ (2o2y C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091104Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2091172Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [82296] (23 PDB entries)
    Uniprot Q9BJJ9 96-424 # fragment
  8. 2091185Domain d2o2yc_: 2o2y C: [138896]
    automated match to d1uh5a_
    complexed with cl, nad, so4, tcl

Details for d2o2yc_

PDB Entry: 2o2y (more details), 2.2 Å

PDB Description: The crystal structure of P. falciparum enoyl acyl carrier protein reductase
PDB Compounds: (C:) enoyl-acyl carrier reductase

SCOPe Domain Sequences for d2o2yc_:

Sequence, based on SEQRES records: (download)

>d2o2yc_ c.2.1.2 (C:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
nedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidk
dkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhs
lanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvp
gygggmssakaalesdtrvlayhlgrnynirintisagplksraatainklnntyenntn
qnknrnshdvhnimnnsgekeekknsasqnytfidyaieysekyaplrqkllstdigsva
sfllsresraitgqtiyvdnglnimflpddiyrn

Sequence, based on observed residues (ATOM records): (download)

>d2o2yc_ c.2.1.2 (C:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
nedicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidk
dkkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhs
lanakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvp
gygggmssakaalesdtrvlayhlgrnynirintisagplksraatainytfidyaieys
ekyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpddiyrn

SCOPe Domain Coordinates for d2o2yc_:

Click to download the PDB-style file with coordinates for d2o2yc_.
(The format of our PDB-style files is described here.)

Timeline for d2o2yc_: