![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) ![]() contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
![]() | Family d.15.2.2: PB1 domain [64225] (11 proteins) Pfam PF00564 forms heterodimers, although not all PB1 domain pairs associate. |
![]() | Protein Mitogen-activated protein kinase kinase kinase 3, MEKK 3 [142978] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142979] (3 PDB entries) Uniprot Q99759 42-123! Uniprot Q99759 43-122 |
![]() | Domain d2o2vb1: 2o2v B:42-123 [138893] Other proteins in same PDB: d2o2va_ |
PDB Entry: 2o2v (more details), 1.83 Å
SCOPe Domain Sequences for d2o2vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o2vb1 d.15.2.2 (B:42-123) Mitogen-activated protein kinase kinase kinase 3, MEKK 3 {Human (Homo sapiens) [TaxId: 9606]} qsdvrikfehngerriiafsrpvkyedvehkvttvfgqpldlhymnnelsillknqddld kaidildrsssmkslrilllsq
Timeline for d2o2vb1: