Lineage for d2o2vb1 (2o2v B:42-123)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933606Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 2933622Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 2933644Protein Mitogen-activated protein kinase kinase kinase 3, MEKK 3 [142978] (1 species)
  7. 2933645Species Human (Homo sapiens) [TaxId:9606] [142979] (3 PDB entries)
    Uniprot Q99759 42-123! Uniprot Q99759 43-122
  8. 2933647Domain d2o2vb1: 2o2v B:42-123 [138893]
    Other proteins in same PDB: d2o2va_

Details for d2o2vb1

PDB Entry: 2o2v (more details), 1.83 Å

PDB Description: crystal structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (map2k5-phox) with human mitogen activated protein kinase kinase kinase 3 (map3k3b-phox)
PDB Compounds: (B:) Mitogen-activated protein kinase kinase kinase 3

SCOPe Domain Sequences for d2o2vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o2vb1 d.15.2.2 (B:42-123) Mitogen-activated protein kinase kinase kinase 3, MEKK 3 {Human (Homo sapiens) [TaxId: 9606]}
qsdvrikfehngerriiafsrpvkyedvehkvttvfgqpldlhymnnelsillknqddld
kaidildrsssmkslrilllsq

SCOPe Domain Coordinates for d2o2vb1:

Click to download the PDB-style file with coordinates for d2o2vb1.
(The format of our PDB-style files is described here.)

Timeline for d2o2vb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2o2va_