![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
![]() | Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (29 PDB entries) identical sequence in many other species |
![]() | Domain d2o25c_: 2o25 C: [138890] Other proteins in same PDB: d2o25a1, d2o25a2, d2o25b1, d2o25b2 automated match to d1kpsa_ |
PDB Entry: 2o25 (more details), 2.6 Å
SCOPe Domain Sequences for d2o25c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o25c_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} sgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfklr mlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqelln epniqdpaqaeaytiycqnrveyekrvraqakkfaps
Timeline for d2o25c_: