Lineage for d2o25b2 (2o25 B:3-156)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546267Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
    ubc1 homologue; also contains the C-terminal UBA domain
  7. 2546270Species Human (Homo sapiens) [TaxId:9606] [143064] (10 PDB entries)
    Uniprot P61086 1-156
  8. 2546278Domain d2o25b2: 2o25 B:3-156 [138889]
    Other proteins in same PDB: d2o25a1, d2o25b1, d2o25c_, d2o25d_
    automated match to d1ylaa2

Details for d2o25b2

PDB Entry: 2o25 (more details), 2.6 Å

PDB Description: Ubiquitin-Conjugating Enzyme E2-25 kDa Complexed With SUMO-1-Conjugating Enzyme UBC9
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOPe Domain Sequences for d2o25b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o25b2 d.20.1.1 (B:3-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]}
niavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqleiki
petypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaaep
ddpqdavvanqykqnpemfkqtarlwahvyagap

SCOPe Domain Coordinates for d2o25b2:

Click to download the PDB-style file with coordinates for d2o25b2.
(The format of our PDB-style files is described here.)

Timeline for d2o25b2: