![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species) ubc1 homologue; also contains the C-terminal UBA domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143064] (3 PDB entries) Uniprot P61086 1-156 |
![]() | Domain d2o25b2: 2o25 B:3-156 [138889] Other proteins in same PDB: d2o25a1, d2o25b1, d2o25c_, d2o25d_ automatically matched to 1YLA A:1-156 |
PDB Entry: 2o25 (more details), 2.6 Å
SCOPe Domain Sequences for d2o25b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o25b2 d.20.1.1 (B:3-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]} niavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqleiki petypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaaep ddpqdavvanqykqnpemfkqtarlwahvyagap
Timeline for d2o25b2:
![]() Domains from other chains: (mouse over for more information) d2o25a1, d2o25a2, d2o25c_, d2o25d_ |